PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PEQU_39789
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
Family MYB
Protein Properties Length: 270aa    MW: 30507.5 Da    PI: 6.8478
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PEQU_39789genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.53.5e-141459148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l++ + ++G g+W+++++  g  +++k+c++rw +yl
       PEQU_39789 14 KGLWSPEEDEKLYNHIIRFGVGCWSSVPKLSG--LCGKSCRLRWINYL 59
                     678****************************8..9***********97 PP

2Myb_DNA-binding47.73.5e-1565109147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++++eE+ l++ +++ lG++ W+ Ia+ ++ gRt++++k++w++ 
       PEQU_39789  65 RGSFSQEEENLIIGLHEVLGNR-WSQIASQLP-GRTDNEIKNFWNSC 109
                      899*******************.*********.***********975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.0E-22662IPR009057Homeodomain-like
PROSITE profilePS5129416.186959IPR017930Myb domain
SuperFamilySSF466894.12E-2612106IPR009057Homeodomain-like
SMARTSM007171.9E-101361IPR001005SANT/Myb domain
PfamPF002494.4E-121459IPR001005SANT/Myb domain
CDDcd001673.89E-91759No hitNo description
PROSITE profilePS5129425.32460114IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.5E-2663114IPR009057Homeodomain-like
SMARTSM007172.8E-1464112IPR001005SANT/Myb domain
PfamPF002496.2E-1465109IPR001005SANT/Myb domain
CDDcd001677.86E-1067107No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 270 aa     Download sequence    Send to blast
MGRHSCCLKQ KLRKGLWSPE EDEKLYNHII RFGVGCWSSV PKLSGLCGKS CRLRWINYLR  60
PDLKRGSFSQ EEENLIIGLH EVLGNRWSQI ASQLPGRTDN EIKNFWNSCL KKKLRQKGID  120
PTTHKLLIEI AGEQEKFNSL NSVHENLTIK PSFDPFPPLE FQGAADQTGA NLIVHDQLHS  180
SLISAPAFCE FSNIMNFSGN YPYGNSSSSS SNWNCAMRGD MSSFVSNEAM NWKSESKLEP  240
IVAAQWPSLS QDPSVPCFEV SRGEFDEDFL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-30711420128MYB TRANSFORMING PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1109115LKKKLRQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009418467.11e-107PREDICTED: myb-related protein Hv33-like
SwissprotQ8LPH62e-78MYB86_ARATH; Transcription factor MYB86
TrEMBLM0U2H81e-102M0U2H8_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr9P22190_0011e-102(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23273391
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26660.12e-79myb domain protein 86